Description
Accession Number: Q8CJ70
Description: Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Source: Genetically modified E.coli.
Predicted MW: Monomer, 17.7 kDa (153 aa)
AA Sequence: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Formulation: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Product Specifications*
*Lot-specific values for the following specifications are supplied with each product on its corresponding COA. The values provided here are minimum expected values to pass internal requirements.
Specification |
Method of Determination |
Acceptance Criteria |
Purity |
Reducing and Non-Reducing SDS PAGE |
≥95% |
Endotoxin |
Kinetic LAL |
≤1 EUs/µg |
Biological Activity |
No biological activity data is available at this time |
No biological activity data is available at this time |
Preparation and Storage
Country of Origin: USA Shipping: Room temperature
Product Reconstitution: Sterile water at 0.1 mg/mL
Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
Expiration Date
12 months from date of receipt when stored at -20°C to-80°C as supplied.
1 month when stored at 4°C after reconstituting as directed.
3 months when stored at -20°C to -80°C after reconstituting as directed.
To receive more information or for a bulk quote, email us at quotes@shenandoah-bt.com.
Part Number: Other Terms:
Reviews
There are no reviews yet.