Shenandoah Biotech Logo

Human IL-35 Heterodimer

Human IL-35 Heterodimer

Part Number: 100-49

Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B).

[bulk_variations include=”5939″]

$67.00$2,005.00

Clear

Description

Alternate Names:  None               Accession Number: Q14213/P29459
Description:  Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
Source:  Genetically modified HEK 293 cells.
Predicted MW: Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa)
AA Sequence:  EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK  p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Formulation:  Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5

Product Specifications*
*Lot-specific values for the following specifications are supplied with each product on its corresponding COA.  The values provided here are minimum expected values to pass internal requirements. 

Specification Method of Determination Acceptance Criteria
Purity Reducing and Non-Reducing SDS PAGE ≥95%
Endotoxin Kinetic LAL ≤5 EUs/µg
Biological Activity No biological activity data is available at this time No biological activity data is available at this time
Preparation and Storage
Country of Origin:  USA        Shipping:  Ice pack
Storage Prior to Reconstitution:  -20°C
Product Reconstitution:  Sterile water at 0.1 mg/mL
Instructions:  Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

Expiration Date
12 months from date of receipt when stored at -20°C to-80°C as supplied.
1 month when stored at 4°C after reconstituting as directed.
3 months when stored at -20°C to -80°C after reconstituting as directed.

To receive more information or for a bulk quote, email us at quotes@shenandoah-bt.com.

Part Number: Other Terms:

Additional information

Weight 0.01 g
Dimensions 1 × 1 × 1 cm
Select size

Midgi: 500 ug, Mini: 2 ug, Std.: 10 ug, Value: 100 ug

Reviews

There are no reviews yet.

Be the first to review “Human IL-35 Heterodimer”