Alternate Names:  None               Accession Number: Q14213/P29459
Description:  Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
Source:  Genetically modified HEK 293 cells.
Predicted MW: Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa)
AA Sequence:  EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK  p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Formulation:  Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5

Preparation and Storage
Country of Origin:  USA        Shipping:  Ice pack

Storage Prior to Reconstitution:  -20°C
Product Reconstitution:  Sterile water at 0.1 mg/mL
Instructions:  Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.